SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024280 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024280
Domain Number 1 Region: 421-540
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 8.89e-26
Family Lamin A/C globular tail domain 0.00018
Further Details:      
 
Domain Number 2 Region: 321-397
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.22e-18
Family Intermediate filament protein, coiled coil region 0.00012
Further Details:      
 
Domain Number 3 Region: 45-78
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000209
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024280
Domain Number - Region: 128-229
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000863
Family Myosin rod fragments 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024280   Gene: ENSPPYG00000009353   Transcript: ENSPPYT00000033542
Sequence length 577
Comment pep:known_by_projection chromosome:PPYG2:19:2416759:2442321:-1 gene:ENSPPYG00000009353 transcript:ENSPPYT00000033542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPSPGRRREQRRPRAAATMATPLAGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHY
IDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIE
IGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAEL
RAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERR
LVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAA
SAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEM
TEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSS
SRGSMSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEID
LEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYVLRAGQMVTVGGGVGGRGW
PRMGCEVGSGDWRCRTWQGWVGMVVAPGTVSEQLPRS
Download sequence
Identical sequences K7EUQ4
ENSPPYP00000024280 ENSPPYP00000024280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]