SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024286 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024286
Domain Number 1 Region: 216-307
Classification Level Classification E-value
Superfamily HMG-box 1.05e-24
Family HMG-box 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024286   Gene: ENSPPYG00000011025   Transcript: ENSPPYT00000033548
Sequence length 490
Comment pep:known_by_projection chromosome:PPYG2:20:41369900:41494863:1 gene:ENSPPYG00000011025 transcript:ENSPPYT00000033548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEHAGPNWNRRWILIKEFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN
LPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLP
TIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGIRSSIAHSSPSPPGS
KSATPSPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSAYALF
FRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRAS
LVSKSSPDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLART
LGSKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPM
ALQVQLAMSPSPPGPQDFPHISEFPSSSGSCSPGPSNPTSSGDWDSSYPSGECGIGTCSL
LPRDKSLYLT
Download sequence
Identical sequences K7EUQ9
ENSPPYP00000024286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]