SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024307 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024307
Domain Number 1 Region: 117-214
Classification Level Classification E-value
Superfamily EF-hand 7.12e-26
Family Eps15 homology domain (EH domain) 0.0000275
Further Details:      
 
Domain Number 2 Region: 264-364
Classification Level Classification E-value
Superfamily EF-hand 5.98e-25
Family Eps15 homology domain (EH domain) 0.0000784
Further Details:      
 
Domain Number 3 Region: 16-105
Classification Level Classification E-value
Superfamily EF-hand 4.71e-17
Family Eps15 homology domain (EH domain) 0.0000891
Further Details:      
 
Domain Number 4 Region: 386-499
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000889
Family Myosin rod fragments 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024307   Gene: ENSPPYG00000009688   Transcript: ENSPPYT00000033569
Sequence length 926
Comment pep:known_by_projection chromosome:PPYG2:19:16753793:16877020:-1 gene:ENSPPYG00000009688 transcript:ENSPPYT00000033569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAH
WAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLD
RDEFAVAMHLVYRALEKEPVPSALPPSLIPPSKRKKTVFPGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPMADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEI
NQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGGFGTMDDP
FKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFKGDPFQNDPFAEQQTTSTDPFGG
DPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSVSSKG
SDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPFKSKQDTPALP
PKKPAPPRPKPPSEAMAEQKNSALYTLLGGKSTPVSQLGSADFPEAPDPFQPLGADSGDP
FQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTSFGNEEQQLAWAKRESEKAEQER
LARLRRQEQEDLELAIALSKADMPAA
Download sequence
Identical sequences K7EUT0
ENSPPYP00000024307 XP_009251198.1.23681 ENSPPYP00000024307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]