SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024320 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024320
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.31e-27
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 192-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 10 Region: 152-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000347
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024320
Domain Number - Region: 122-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00476
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024320   Gene: ENSPPYG00000005152   Transcript: ENSPPYT00000033582
Sequence length 687
Comment pep:known chromosome:PPYG2:12:136165134:136179685:1 gene:ENSPPYG00000005152 transcript:ENSPPYT00000033582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPDVIFKLEQGEEPWVGDGEIPSSDSPEVWKVDGNMMWHQDNQDKLKIIKRGHECDAFG
KNFNLNMNFVPLRKSNNEGDLDGLILKHHLDLLIPKGDYGKAESDDFNVFDNFFLHSKPE
DTDTWLKYYDCDKYKESYKKSQIIIYHRNRLGEKLYECSECRKRFSKKPSLIKHQSRHIR
DIAFGCGNCGKTFPQKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTSHQRTHTGEKPY
ECGECGKAFSRKSHLISHWRTHTGEKPYGCNECGRAFSEKSNLINHQRIHTGEKPFECRE
CGKAFSRKSQLVTHHRTHTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKA
FRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFICSKCGKAFSRK
SQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLI
SHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLNTHQR
IHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECNECRKAFREKSSLINHQRIHTG
EKPFECSECGKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVNHQRIHTGEKPY
QCIECGKAFSQKSQLINHQRTHKVKKS
Download sequence
Identical sequences K7EUU3
ENSPPYP00000024320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]