SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024348 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000024348
Domain Number - Region: 64-240
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00183
Family LacY-like proton/sugar symporter 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024348   Gene: ENSPPYG00000018175   Transcript: ENSPPYT00000033611
Sequence length 252
Comment pep:known_by_projection chromosome:PPYG2:7:148478098:148482599:1 gene:ENSPPYG00000018175 transcript:ENSPPYT00000033611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLQEGDCGGSQTVSLTMGTADSDEMAPEAPQRTHIDVHIHQESALAKLLLTCCSALRPR
ATQSRGSSRLLVASWVMQIVLGILSAVLGGFFYICDYTLLVTSGAAIWTGAVAVLAGTAA
FIYEKRGGTYWALLRTLLALAAFSTAIAALKLWNEDFRYGYFYYNSACHISSSSNWNTPA
PTQSPEEVRRLHLCTSFMDMLKALFITLQAMLLGVWILLLLASLAPLWLYCWRRFPTKGK
RNQKEMLEVSGI
Download sequence
Identical sequences K7EUX1
ENSPPYP00000024348 XP_002818720.3.23681 ENSPPYP00000024348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]