SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024362 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024362
Domain Number 1 Region: 143-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.19e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 105-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 577-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 386-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000152
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 11 Region: 302-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000305
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 12 Region: 77-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000276
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024362   Gene: ENSPPYG00000009105   Transcript: ENSPPYT00000033625
Sequence length 672
Comment pep:known chromosome:PPYG2:18:47393642:47413239:1 gene:ENSPPYG00000009105 transcript:ENSPPYT00000033625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIQFNYESQEHHLLSDGENKTKIGKPASEEGITAKIEPLTEESSSLRENVLQDSEGREF
CEFGDKLNEKDQNVFKRRPHNCDEYGQSFVWNTGLFRHRKTHCEKPYECDKCGKAFSVSS
ALVLHQRIHTGEKPYSCNWCIKSFSRSSDLIKHQRVHTGEKPYKCDECGKAFSQSSDLII
HQRIHTGEKPYQCSHCSKSFSQRSDLVKHQRIHTGEKPYTCNQCNKHFSQSSDVIKHQRI
HTGEKPYKCDVCAKAFSQSSDLILHQRIHSGEKPYPCNQCSKSFSQNSDLIKHRRIHTGE
KPYKCNECGKAFNQSSVLILHQRIHTGEKPYPCDQCSKTFSRLSDLINHQRIHTGEKPYP
CNQCNKMFSRRSDLVKHHRIHTGEKPYECDECGKTFSQSSNLILHQRIHTGEKPYPCSDC
TKSFSRRSDLVKHQRIHTGEKPYACNQCDKSFSQSSDLTKHQRVHSGEKPYHCNSCEKAF
SQSSDLILHQRIHTGEKPYLCTQCSKSFSQNSDLIKHQRIHTGEKPYKCSECRKAFSQCS
ALTLHQRIHTGEKPNPCDECGKSFSRHSDLINHQKIHTGEKPYKCDACGKAFSTCTDLIE
HQKIHAGEKPYRCVQCSRSFSQLSELTIHEEVHCGEDSQNVMNVRKPLVYTSTLFSTRDT
VPGKNLMNAVDY
Download sequence
Identical sequences H2NW65
ENSPPYP00000010224 9600.ENSPPYP00000010224 ENSPPYP00000010224 ENSPPYP00000024362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]