SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024370 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024370
Domain Number 1 Region: 13-644
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.85e-229
Family Motor proteins 0.0000000000000327
Further Details:      
 
Domain Number 2 Region: 645-769
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.59e-26
Family Myosin rod fragments 0.00000424
Further Details:      
 
Domain Number 3 Region: 1041-1158
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.18e-25
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number 4 Region: 767-875
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.89e-21
Family Myosin rod fragments 0.0017
Further Details:      
 
Domain Number 5 Region: 1237-1357
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000288
Family Myosin rod fragments 0.0043
Further Details:      
 
Domain Number 6 Region: 1611-1719
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000314
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number 7 Region: 873-988
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000314
Family Myosin rod fragments 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024370
Domain Number - Region: 1159-1273
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000602
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number - Region: 1501-1609
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00279
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number - Region: 1377-1436
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00366
Family Myosin rod fragments 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024370   Gene: ENSPPYG00000010945   Transcript: ENSPPYT00000033633
Sequence length 1741
Comment pep:known_by_projection chromosome:PPYG2:20:32196694:32218957:1 gene:ENSPPYG00000010945 transcript:ENSPPYT00000033633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVFFPQQFLATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPSGK
LASADIDSYLLEKSRVIFQLPGERSYHVYYQILSGKKPELQDMLLLSMNPYDYHFCSQGV
ITVDNMNDGEELIATDHAMDILGFSMDEKCACYKIVGALLHFGNMKFKQKQREEQAEADG
TESADKAAYLMGVSSGDLLKGLLHPRVRVGNEYVTKGQSVEQVVFAVGALAKATYDRLFR
WLVSRINQTLDTKLPRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNQHMFVLE
QEEYKREGIDWVFIDFGLNLQPCIDLIEKPLGILSILEEECMFPKASDASFRAKLYDNHA
GKSPNFQQPRPDKKRKYQAHFEVVHYAGVVPYSIVGWLEKNKDPLNETVVPIFQKSQNRL
LATLYENYAGSCSTEPPKSGVKEKRKKAASFQTVSQLHKENLNKLMTNLRATQPHFVRCI
VPNENKTPGVMDAFLVLHQLRCNGVLEGIRICRQGFPNRLLYTDFRQRYRILNPSAIPDD
TFMDSRKATEKLLGSLDLDHTQYQFGHTKVFFKAGLLGVLEELRDQRLAKVLTLLQARSR
GRLMRLEYQRLLGGRDALFTIQWNIRAFNAVKNWSWMKLFFKMKPLLRSAQAEEELAALR
AELRGLRGALAAAEAKRQELEETHVSVTQEKNDLALQLQAEQDNLADAEERCHLLIKSKV
QLEGKVKELSERLEDEEEVNADLAARRRKLEDECTELKKDIDDLELTLAKAEKEKQATEN
KVKNLTEEMAALDESVARLTKEKKALQEAHQQALGDLQAEEDRVSALTKAKLRLEQQVED
LECSLEQEKKLRMDTERAKRKLEGDLKLTQESVADAAQDKQQLEEKLKKKDSELSQLSLR
VEDEQLLGAQMQKKIKELQARAEELEEELEAERAARARVEKQRAEAARELEELSERLEEA
GGASAGQREGCRKREAELGRLRRELEEAALRHEATVAALRRKQAEGTAELGEQVDSLQRV
RQKLEKEKSELRMEVDDLAANVETLTRAKASAEKLCRTYEDQLSEAKIKVEELQRQLADA
STQRGRLQTESGELSRLLEEKECLISQLSRGKALAAQSLEELRRQLEEESKAKSALAHAV
QALRHDCDLLREQHEEEAEAQAELQRLLSKANAEVAQWRSKYEADAIQRTEELEEAKKKL
ALRLQEAEEGVEAANAKCSSLEKAKLRLQTESEDVTLELERATSAAAALDKKQRHLERAL
EERRRQEEEMQRELEAAQRESRGKGTELFRLRHSHEEALEALETLKRENKNLQEEISDLT
DQVGLSGKSIQELEKAKKALEGEKSEIQAALEEAEGALELEETKTLRIQLELSQVKAEVD
RKLAEKDEECANLRRNHQRAVESLQASLDAETRARNEALRLKKKMEGDLNDLELQLGHAT
RQATEAQAATRLMQAQLKEEQAGRDEEQRLAAELREQAQALERRASLLAAELEELRAALE
QGERSRRLAEQELLEATERLNLLHSQNTGLLNQKKKLEADLAQLSGEVEEAAQERREAEE
KAKKAITDAAMMAEELKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQVQ
KLEAKVRELEAELDAEQKQHAEALKGVRKHERRVKELAYQAEEDRKNLARMQDLVDKLQS
KVKSYKRQFEEAEQQANTNLAKYRKAQHELDDAEERADMAETQANKLRARTRDALGPKHK
E
Download sequence
Identical sequences K7EUZ3
ENSPPYP00000024370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]