SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024388 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024388
Domain Number 1 Region: 64-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.14e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024388   Gene: ENSPPYG00000029376   Transcript: ENSPPYT00000033650
Sequence length 297
Comment pep:known_by_projection chromosome:PPYG2:X:49815336:49824315:-1 gene:ENSPPYG00000029376 transcript:ENSPPYT00000033650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSYLPGGTTGLQLPSTLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEA
KALLKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRK
LQKEQQRSKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDS
LKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFH
LGLEDILMEEEEGVVGGLSGGALSPLRAASDPLLSSVSPAVSKASSRRSSFSMEEES
Download sequence
Identical sequences K7EV11
ENSPPYP00000024388 ENSPPYP00000024388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]