SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024395 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024395
Domain Number 1 Region: 225-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 169-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 468-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 426-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000351
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 351-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000367
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024395   Gene: ENSPPYG00000018158   Transcript: ENSPPYT00000033657
Sequence length 594
Comment pep:known_by_projection chromosome:PPYG2:7:147585850:147594932:-1 gene:ENSPPYG00000018158 transcript:ENSPPYT00000033657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEG
AHTEQAEAPCRGQACTAQKAQPVGACPGEEWMIRKVKVEDEDQEAEEEVEWPQHPSLLPS
PFPPPDLGHLAAAYKLEPGAPGALSGLALSGWGPTPEKPYGCGECERRFRDQLTLRLHQR
LHRGEGPCACPDCGRSFTQRAHMLLHQRSHRGERPFPCSQCDKRFSKKAHLTRHLRTHTG
ERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKRFRKKTHLIRHQRIHTGERPY
QCAQCARSFTHKQHLVRHQRVHQAAGPARPSPDSSASPHSTAPSPTPSPPGPKPFACSDC
GLSFGWKKNLATHQCLHRSDGRPFGCDECALGATVDAPAPEPLASAPGGPGCGPGSDPVA
PQRAPSGERSFFCPDCGRGFAHGQHLARHRRVHTGERPFACTQCDRRFGSRPNLVAHSRA
HSGARPFACAQCGRRFSRKSHLGRHQAVHTGSRPHACAVCARSFSSKTNLVRHQAIHTGS
RPFYCPQCGKSFSRKTHLVRHQLITAKPPRGSGRRLAAPAWSTPPEAAPPPLFF
Download sequence
Identical sequences K7EV17
ENSPPYP00000024395 XP_002818689.2.23681 ENSPPYP00000024395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]