SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024411 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024411
Domain Number 1 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 227-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 115-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 59-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000113
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 3-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000264
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024411   Gene: ENSPPYG00000029611   Transcript: ENSPPYT00000033672
Sequence length 361
Comment pep:novel chromosome:PPYG2:19:23848251:23849336:-1 gene:ENSPPYG00000029611 transcript:ENSPPYT00000033672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVFHKFSNLNGHKVRHTEKKPFKCKEFGKSLCMFSNLTQHKIICTRVNFYKCKDCGKAF
NGSSIFTKHKRIHIGEKLYICEECGKACNQFTNLTTHKIIYTREKLYKREECSKAFNLSS
HITTHTIIHTGENPYKREECGKAFNQSSTLTTHKIIHTREKLNEYKECGKAFNQSSHLTR
HKIIHTGEKPYKCEECGKAFNQSSHLTRHKIIHTGEKPYKCEECGKAFRQSSHLTTHKII
HTGEKPYKCEECGKAFNKSSHLTRHKSIHTGEKPYQCEKCGKASNQSSNLTEHKNIHTEE
KPYKCEECGKAFNQFSNLTTHKEFILERNPTNVKNVAKLLTSPQSLLHIREFHTGREILQ
M
Download sequence
Identical sequences K7EV33
ENSPPYP00000024411 ENSPPYP00000024411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]