SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024412 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024412
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.63e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024412   Gene: ENSPPYG00000000944   Transcript: ENSPPYT00000033673
Sequence length 332
Comment pep:known chromosome:PPYG2:1:106450454:106473231:-1 gene:ENSPPYG00000000944 transcript:ENSPPYT00000033673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGASGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
STSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKTP
EGFNGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL
TYFMRKICGQSLANKYVERKISQRFDHEMFGLKPKHRFIRHENLWFLHGLRSGHVNGFLQ
AGHGASRSQGSGLCPDAQGGSKTLFRIRGGCV
Download sequence
Identical sequences K7EV34
ENSPPYP00000024412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]