SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024428 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024428
Domain Number 1 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 494-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 326-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-21
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 8 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 550-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 180-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000033
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024428   Gene: ENSPPYG00000029682   Transcript: ENSPPYT00000033690
Sequence length 652
Comment pep:known_by_projection chromosome:PPYG2:19:53509533:53525899:-1 gene:ENSPPYG00000029682 transcript:ENSPPYT00000033690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINAQELLTLEDVTVEFTWEEWQLLDPFQKDLYRDVTLEIYSNLVSMGYQVSKPDALSKL
EQGEEPWTMEDERHSRICPENNKVDDHLQDHLENQWMLKSVEQYHEHNAFGNTASQTKSL
CLFRENHDTFELYIKTLKSNLSLVNQKKSCEIKNSTKFNGDGKSFLHGNYEELYSAAKFS
VSTKSNSTKSQVSKHQRTHEIEKNHICSECGKAFVKKSQLTDHERVHTGEKPYGCTLCAK
VFSRKSRLNEHQRIHKREKSFICSECGKVFTMKSRLIEHQRTHTGEKPYICNECGKGFPG
KRNLIVHQRNHTGEKSYVCSECGKGFTGKSMLIIHQRTHTGEKPYICSECGKGFTTKHYV
IIHQRNHTGEKPYICNECGKGFTMKSRMIEHQRTHTGEKPYVCNECGKGFPRKSNLIVHQ
RNHTVEKSYLCSECGKGFTVKSMLIIHQRTHTGEKPYICSECGKGFPLKSRLIVHQRTHT
GEKPYRCSECGKGFIVNSGLMLHQRTHTGEKPYICNECGKGFAFKSNLVVHQRTHTGEKP
FMCSECGKGFTMKRYLIVHQQIHTEEKSCICSECGRGFAKETELALHKQVHTGEKPYGCN
ECGKGFTMKSRLIVHQRTHTGEKPFVCSECRKAFSSKRNLIVHQRTHNGNKP
Download sequence
Identical sequences K7EV49
ENSPPYP00000024428 XP_009231283.1.23681 XP_009231284.1.23681 ENSPPYP00000024428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]