SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024460 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024460
Domain Number 1 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.81e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-17
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 125-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000153
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000288
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024460   Gene: ENSPPYG00000017532   Transcript: ENSPPYT00000033721
Sequence length 504
Comment pep:known_by_projection chromosome:PPYG2:7:22536002:22558392:-1 gene:ENSPPYG00000017532 transcript:ENSPPYT00000033721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYRNLVFLGIAVSKPDLITCLEQGKEPCNMKRHAMVAKPPVVCSHFAQDLWPKQGLK
DSFQKVILRRYGKYGHENLQLRKGCKSVDEHKVHKRGYNGLNQCLTTTQSKIFQCDKYVK
VLHKFSNSNTHKKRHTGKKPFKCKECGKSCCILSQLTQHKKTATRVNFYKCKTCGKAFNQ
FSNLTKHKLIHTEVNPYKCEECGKAFNQSLTLTKHKKIHTEEKPYKCEHCGKVFSVFSVL
TKHKIIHTGTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCNECGKAFNWSSTLTKHK
RIHTGEKPYKCEECGKAFNQSSTLTRHKIVHTGEKPYKCEECGKAFKRSTTLTKHKRIYT
KEKPYKCEECGKAFSVFSTLTKHKIIHTGAKPYKCEECGSAFRAFSTLTEHKRVHTGEKP
YKCNECGRAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNRSSNLTRHKKIHTGQKPYKPK
RCDSAFDNTSNFSRHKRNHTGEKS
Download sequence
Identical sequences K7EV79
XP_002817952.1.23681 ENSPPYP00000024460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]