SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024511 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024511
Domain Number 1 Region: 95-259
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000000144
Family Pentapeptide repeats 0.021
Further Details:      
 
Domain Number 2 Region: 410-533
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000502
Family Canonical RBD 0.0037
Further Details:      
 
Domain Number 3 Region: 647-746
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000516
Family Canonical RBD 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024511
Domain Number - Region: 948-990
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0536
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024511   Gene: ENSPPYG00000013855   Transcript: ENSPPYT00000033774
Sequence length 1015
Comment pep:known_by_projection chromosome:PPYG2:3:96418381:96552416:-1 gene:ENSPPYG00000013855 transcript:ENSPPYT00000033774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGDPRPANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSLPFDFQGH
SGPPFANVEEHSFSYGARDGPHGDYRGGEGPGHDFRGGDFSSSDFQSRDSSQLDFRGRDI
HSGDFRDREGLPMDYRGGDGTSMDYRGREAPHMNYRDRDAHAVDFRGRDAPPSDFRGRGT
YDLDFRGRDGSHADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGS
GTTDLDFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMQFKDREMPPVDPNILDYIQPST
QDREHSGMNVNRREESTHDHTIEMPAFGIQKGEFEHSETRERETQGVAFEHESPADFQNS
QSPVQDQDKSQLSGGEQQSSDAGLFKEEGGLDFLGRQDTDYRSMEYRDVDHRLPGSQMFG
YGQSKSFPEGKTARDAQRDLQDQDYRTGPSEEKPSRLIRLSGVPENATKEEILNAFRTPD
GMPVKNLQLKEYNTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIQDKEVTLEYVPSLDFW
YCKRXKASIGGHRSSCSFCKNPREVTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADK
EPELRKREEGQESRLGHQKREAERYLPPSRREGPTFRRDREKESWSGETRQDGESKTIML
KRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQ
NLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNR
QGQQSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGK
SSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNP
LIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQHQKREEQTKKENEEDKLTDWNKLACLLC
RRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREVNFGDLLFP
Download sequence
Identical sequences K7EVC9
ENSPPYP00000024511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]