SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024519 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000024519
Domain Number - Region: 119-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000154
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 174-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00782
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number - Region: 320-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0969
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024519   Gene: ENSPPYG00000009508   Transcript: ENSPPYT00000033782
Sequence length 383
Comment pep:known_by_projection chromosome:PPYG2:19:8731735:8736056:-1 gene:ENSPPYG00000009508 transcript:ENSPPYT00000033782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKPSGPSPDMLATAESSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGG
AGGMQQGSSPAPDSCQPGPGPSPGLTSIVSGTGEDLRPPRRRPPPGKQIPCSSPGCCLSF
PSVRDLAQHLRTHCPPTQSLEGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCEN
CLLRFRTHRSLFKHLHVCAEHAQSPAPPPPPALDREPPAPERPPEVDPASAPGLQFPLLE
PFTTPAPAPTGPFLSYLNPAPFGLSPPRLRPFLAAAPGLPASSAAVWKKSQGAGSSPRRP
QGGSDAPSGHAAPSRIVWEHTRGRYSCMQCAFSTASRPAMTLHLEDHRPGAPAAPAPGPP
RPDAPAGKAEECAGGEGGGGPRR
Download sequence
Identical sequences K7EVD7
ENSPPYP00000024519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]