SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024543 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024543
Domain Number 1 Region: 44-331,516-579
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.91e-89
Family FAD-linked reductases, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 338-520
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.79e-56
Family GMC oxidoreductases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024543   Gene: ENSPPYG00000013786   Transcript: ENSPPYT00000033808
Sequence length 599
Comment pep:known_by_projection chromosome:PPYG2:3:92449775:92473607:1 gene:ENSPPYG00000013786 transcript:ENSPPYT00000033808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLLRGLGRPGTLARGALARGALGQQQPLGARALASAGSESRDEYSYVVVGAGSAGCVL
AGRLTEDPAERVLLLEAGPKDVRAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGL
DGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGACGWDYAHCLPYFRKAQGHEL
GASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEG
KRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILS
GGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSA
QKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPT
QQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQ
EALAPFRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVL
GVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGRPELWDKDVPVYKPRTLATQR
Download sequence
Identical sequences H2PAH4
9600.ENSPPYP00000015426 ENSPPYP00000015426 XP_002813677.1.23681 ENSPPYP00000015426 ENSPPYP00000024543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]