SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024544 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024544
Domain Number 1 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 474-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 249-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 515-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 213-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000525
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 89-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000144
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024544   Gene: ENSPPYG00000029749   Transcript: ENSPPYT00000033809
Sequence length 576
Comment pep:novel chromosome:PPYG2:19:60019162:60027838:-1 gene:ENSPPYG00000029749 transcript:ENSPPYT00000033809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARRHPTQGTVTFEDVAVNFSQEEWCLLSEAQRCLYRDVMLENLALISSLGCWCGSK
DEEAPCKQRISLQRESQSRTPRTVISPKKAHPCEMCGLILEDVYHFADHQETHHKQKLNR
SGACGKNLDDTANLHQHQKQHIGEKFYRKSVRETSFVKKRKLRVSQEPFVFHEFGKDILP
SSGLCQEEAAYPVEKTDSETTHGPPFQEGKTNYRCGKCTKAFSTKHSVIPHQKLFTRDGC
YVCSDCGKSFSRYVSFGNHQRDHTGKGPYDCRECGKSYSRKSSLIQHQQVHTGKTAYPCE
ECGKSFSQKGSLISHQRVHTGEGPYECREYGKSFGQKGNLIQHQRRHTGETAYHCGECGK
SFHQKFCFINHQRVHTGERPYKCGECGKSFGQKGNLVQHQRGHTGERPYECKECGKSFRY
RSHLTEHQRLHTGERPYSCRECGKLFNRKYHLLVHERVHTGERPYECEICGKLFGNKNCV
TIHQRIHTGERPYECSECGKSFLSSSALHVHKRVHSGQKPYKCSECGKSFSECSSLIKHR
RIHTGERPYECTKCGKTFQRSSTLLHHQSSHRRKAL
Download sequence
Identical sequences K7EVG0
XP_009231517.1.23681 ENSPPYP00000024544 ENSPPYP00000024544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]