SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024554 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000024554
Domain Number - Region: 98-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 11-84
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0929
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024554   Gene: ENSPPYG00000007962   Transcript: ENSPPYT00000033819
Sequence length 328
Comment pep:known chromosome:PPYG2:17:8448762:8486063:1 gene:ENSPPYG00000007962 transcript:ENSPPYT00000033819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQ
RNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQ
ANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQE
LAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENTFPSPKAIPNGFG
TSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYISGNVNCGVLNGNG
TKFSRSGHTSFFDKGQEKVIFPTLFMGQ
Download sequence
Identical sequences K7EVG9
ENSPPYP00000024554 XP_009249558.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]