SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024556 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000024556
Domain Number - Region: 5-75
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0256
Family Myosin rod fragments 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024556   Gene: ENSPPYG00000029516   Transcript: ENSPPYT00000033821
Sequence length 205
Comment pep:known_by_projection chromosome:PPYG2:17:2630206:2660206:-1 gene:ENSPPYG00000029516 transcript:ENSPPYT00000033821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREAQSHQQEAASRELESKCRALESQLEARATANAELRREVAQREALVSALRCSLRTEER
RFLEELRRRSHRATVLGTELQKHTEAAAYLSCQLHAARQRLQAPRPGSGATAEPRPRRRA
PRARRPPAAHEAAAKGPGRDWAAWDRGAGALDDADPMPDPALFLYARRPLRPSARSPRQP
PPQEPPDRAGPQPAPSQPSAPGDPE
Download sequence
Identical sequences K7EVH1
ENSPPYP00000024556 ENSPPYP00000024556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]