SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024564 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024564
Domain Number 1 Region: 154-309
Classification Level Classification E-value
Superfamily EF-hand 4.72e-28
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 2 Region: 25-137
Classification Level Classification E-value
Superfamily EF-hand 9.28e-18
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024564   Gene: ENSPPYG00000017982   Transcript: ENSPPYT00000033829
Sequence length 315
Comment pep:known chromosome:PPYG2:7:125620251:125654748:1 gene:ENSPPYG00000017982 transcript:ENSPPYT00000033829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT
FDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQ
DGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEF
RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
Download sequence
Identical sequences A0A024R755 A0A2I2ZSU5 A0A2J8QT27 A0A2K5P6T3 A0A2K6BGV5 A0A2K6QUL3 G7P0M0 H9EN05 K7EVH9
9598.ENSPTRP00000033677 NP_001124146.1.87134 NP_001124146.1.92137 NP_001247730.1.72884 XP_003261348.1.23891 XP_003813556.1.60992 XP_004046227.2.27298 XP_005550769.1.63531 XP_007981044.1.81039 XP_009241481.1.23681 XP_009452282.1.37143 XP_010377045.1.97406 XP_011727605.1.29376 XP_011794949.1.43180 XP_011851300.1.47321 XP_011943385.1.92194 ENSMMUP00000012585 ENSP00000408838 ENSP00000408838 gi|194578885|ref|NP_001124146.1| ENSPPYP00000024564 ENSPPYP00000020173 ENSMMUP00000012584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]