SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024582 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024582
Domain Number 1 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 184-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 9 Region: 590-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 10 Region: 140-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000119
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 339-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000114
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024582   Gene: ENSPPYG00000029775   Transcript: ENSPPYT00000033847
Sequence length 648
Comment pep:known_by_projection chromosome:PPYG2:4:40333:76483:1 gene:ENSPPYG00000029775 transcript:ENSPPYT00000033847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLGFVISNPDLVTCLEQIK
EPCDLKIHETAAKPPAICSPFSQDLSPVQGVEDSFHKLILRRYEKCGHENLQLRKGCKRV
NECKVQKGVNNGVYQCLSTTQSKIFQCNTCVKVFSKFSNSNKHKIRHTGEKPFKCTECGR
SFYMSHLTQHTGIHAGEKPYKCEKCGKAFNRSTSLSKHKRIHTGEKPYTCEECGKAFRRS
TVLNEHKKIHTGEKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCKECGKAFRWSTSLN
EHKNIHTGEKPYKCKECGKAFRQSRSLNEHKNIHTGEKPYTCEKCGKAFNQSSSLIIHRS
IHSEQKLYKCEECGKAFTWSSSLNKHKRIHTGEKPYTCEECGKAFYRSSHLAKHKRIHTG
EKPYTCEECGKAFNQSSTLILHKRIHSGQKPYKCEECGKAFTRSTTLNEHKKIHTGEKPY
KCEECGKAFIWSASLNEHKNIHTGEKPYKCKECGKAFNQSSGLIIHRSIHSEQKLYKCEE
CGKAFTRSTALNEHKKIHSGEKPYKCKECGKAYNLSSTLTKHKRIHTGEKPFTCEECGKA
FNWSSSLTKHKIIHTGEKSYKCEECGKAFNRPSTLTVHKRIHTGEEHS
Download sequence
Identical sequences K7EVJ7
ENSPPYP00000024582 ENSPPYP00000024582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]