SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024601 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024601
Domain Number 1 Region: 53-259
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.85e-36
Family AlkB-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024601   Gene: ENSPPYG00000029809   Transcript: ENSPPYT00000032959
Sequence length 270
Comment pep:known_by_projection chromosome:PPYG2:19:36843058:36848059:-1 gene:ENSPPYG00000029809 transcript:ENSPPYT00000032959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGGNGWRGMGMLNLEIRGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPD
FISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSD
LSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDP
TEQPRPPPRPTTSLLLEPRSLLVLRGTAYTRFLHGIAAARVDALDTASPPPNAAACPSAR
PGACLVRGTRVSLTIRRVPRVLRAGLLLGK
Download sequence
Identical sequences K7EVL5
ENSPPYP00000024601 ENSPPYP00000024601 XP_002829142.3.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]