SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024605 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024605
Domain Number 1 Region: 22-109
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-37
Family SCAN domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 390-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000244
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 209-251
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000471
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 4 Region: 326-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000168
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024605   Gene: ENSPPYG00000010507   Transcript: ENSPPYT00000033868
Sequence length 450
Comment pep:known chromosome:PPYG2:19:60604273:60609015:1 gene:ENSPPYG00000010507 transcript:ENSPPYT00000033868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPLGPPCLPLMDPETTLEEPETARLRFRGFCYQEVAGPREALARLRELCRQWLQPEAH
SKEQMLEMLVLEQFLGTLPPEIQAWVRSQRPGSPEEAAALVEGLQDDPGQLLGWITAHVL
KQEVLPAAQKTEEPLGSPHPSGTVESPGEGPQVTRIERSVQLSCSVKEEPNVDGQEVAPS
SPPLAAQSAEGHHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLP
PHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGLPGCPEAQPPQGPGPAAWEGLSGAATA
APTVRPRTPPVPTQPKPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIHHRTHTSGPGA
QSPGLATGESTEKPPQRELAFPHHPRRSLTGPRSYPCEECGCSFSWKSQLVIHRKSHTGQ
RRHFCSDCGRAFDWKSQLVIHRKGHRPEAP
Download sequence
Identical sequences K7EVL9
ENSPPYP00000024605 ENSPPYP00000024605 XP_009231466.1.23681 XP_009231467.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]