SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024609 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024609
Domain Number 1 Region: 31-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000223
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 248-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000628
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 76-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000129
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024609   Gene: ENSPPYG00000029590   Transcript: ENSPPYT00000033872
Sequence length 341
Comment pep:known_by_projection chromosome:PPYG2:16_random:8210338:8211363:-1 gene:ENSPPYG00000029590 transcript:ENSPPYT00000033872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLARDLIAVPSAARPAVAAPTSSSTSESTREKPFVSGECGKGLAASSAAGSPSTHWPCVC
PQCQQVFGDRWKLICHQRIHTGERPFCCCSCGDSVNEKTSLSQRVLPHPGKKTCRRGSVE
SVILAPSSVAPGSTSGLRPFGSPGSFLQRLPPSTLLPRPPFLYPGPPLSLQPLVPSGLPG
LREAWKLPRFRQSPSRQLSRRGRWGPEAVRARDGTCGRRFRPQATLSQPGRPRSTERPDR
SARPGPGFSDSAELLRHPRTHTGEEPYQCFRCGRPPAGGPTWPDTEEPACCSPGWNSCSP
RWTVDLRCSPLPPHRPAQDGFSVWQIFLRSAGGYFVCFFPP
Download sequence
Identical sequences K7EVM3
ENSPPYP00000024609 ENSPPYP00000024609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]