SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024629 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024629
Domain Number 1 Region: 137-249
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.57e-31
Family Frizzled cysteine-rich domain 0.00061
Further Details:      
 
Domain Number 2 Region: 453-530
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.23e-22
Family Frizzled cysteine-rich domain 0.00068
Further Details:      
 
Domain Number 3 Region: 383-424
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 306-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 342-380
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 269-306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024629   Gene: ENSPPYG00000029738   Transcript: ENSPPYT00000033892
Sequence length 530
Comment pep:novel chromosome:PPYG2:4:49167713:49362288:-1 gene:ENSPPYG00000029738 transcript:ENSPPYT00000033892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVL
LLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTVYNQSTVVSTEHPDHHVPA
WTTDASLPGDQSHRNTSACMNITHSQCQMLPYHTTLTPLLSVVRNMEMEKFLKFFTYLHR
LNCYQHIMLFGCSLAFPECIIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLRC
SQFRNQTESSNVSRICFSPQQENGKQLLCGGDESFLCASGICVPRKLQCNGYNDCDDWSD
EAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCITMEW
VCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTP
CQEGDQRCVYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHR
TQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTGQRIPPCR
Download sequence
Identical sequences K7EVP3
ENSPPYP00000024629 ENSPPYP00000024629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]