SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024664 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024664
Domain Number 1 Region: 324-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 603-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 3 Region: 799-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 841-893
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 743-800
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.12e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 687-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 17-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-18
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 12 Region: 215-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000725
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 13 Region: 370-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000306
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 651-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000545
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 15 Region: 510-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000005
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024664   Gene: ENSPPYG00000029644   Transcript: ENSPPYT00000033926
Sequence length 903
Comment pep:known_by_projection chromosome:PPYG2:19:54000908:54069755:1 gene:ENSPPYG00000029644 transcript:ENSPPYT00000033926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKYLNPAQRALYREVMLENYRNL
EAVDISSKCMMKEVLSTGQGNSEVFYTGTLQRHESHRIGDFCFQEIEKDINDIEFQCQED
ERNGHEVPMTKIKKLTGSTDRYDHRHAGNKPINDQLESSFYSHLPELHIFQIKGKIGNQL
EKSTNDGPSVSTSQRISCRPQIHISNNYGNSPPNSSLLPQKQEVHMREKSFPCDESGKAF
NCSSLLRKHQIIHLGDKQYKCDVCGKLFNHKQYLSCHRRCHTGEKPYKCNECGKSFSYRS
SLTCHHRLHTGVKPYKCNECGKIFRQNSALVIHKAIHTGEKPYKCNECGKAFNQQSHLSR
HQRLHTGVKPYKCKICDKAFVCHSYLANHTRIHSGEKTYKCNECGKAFNHQSSLARHHIL
HTGEKPYKCEECDKVFNQKSTLERHKRIHTGEKPYKCKVCDTAFMCNSQLARHRRIHTGE
KTYKCNECHKTFSRRSSLLCHRRLHSGEKPYKCNECGNTFRHRASLVYHRRLHTLEKSYK
CTVCDKAFMRNSVLAVHTRIHTARKPYKCNECGKAFNQQSHLSRHHRLHTGEKPYKCEAC
DKVFSQKSALESHKRIHTGEKPYKCQVCDIAFTWNSQLARHTRIHTGEKTYKCNECGKTF
SYKSSLVWHRRLHGGEKSYKCKVCDKAFVCHSYVVKHTRIHSGMKPFKCNECSKTFSNRS
SLVCHRRVHSGEKPYKCNECSKTFSQKASLLCHRRLHSGEKPYKCNECGNTFRHWSSLVY
HRRLHTGEKSYKCTVCDKAFVRNSYLARHTRIHTAEKPYKCNECGKAFNEQSHLSRHHRI
HTGEKPYKCEACDKVFSRKSHLKRHRRIHTGEKPYKCNECGKAFSDRSTLIHHQAIHGVG
KFD
Download sequence
Identical sequences K7EVS8
ENSPPYP00000024664 ENSPPYP00000024664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]