SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024691 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024691
Domain Number 1 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 2 Region: 424-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 313-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 472-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000999
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024691
Domain Number - Region: 279-327
Classification Level Classification E-value
Superfamily Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.000379
Family Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0052
Further Details:      
 
Domain Number - Region: 1-38
Classification Level Classification E-value
Superfamily POZ domain 0.000863
Family BTB/POZ domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024691   Gene: ENSPPYG00000014601   Transcript: ENSPPYT00000033955
Sequence length 685
Comment pep:known_by_projection chromosome:PPYG2:4:9066189:9085898:-1 gene:ENSPPYG00000014601 transcript:ENSPPYT00000033955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLT
PDATCVISENSYPPHFLQECSADAQQDKTLDESHPRASPSVSRHHSAGEISKQAPDTSDG
SCTELPFKQPNYYYKLRNFYSKQYHKHTAGPSQERVIEQPFAFSTSTDLTTVESQPCAVS
HSECILESPEHLPSNFLAQPVNESAPHPESEATCQQPAKQMRLKKAIHLKKLNFLKSQKS
AEQVSEPKSDDGLTKRMESASENTLEKASSGSAEEKESEEVVSCENFNCISETERPEDPA
ALEDQSQTLQSQRQYACELCGKPFKHPSNLELHKRSHTGEKPFECNICGKHFSQAGNLQT
HLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPHLCDICGRGFSNFSNLKEHKKT
HTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSACGKCFGGSGDLRRHVRTHTGE
KPYTCEICNKCFTRSAVLRRHKKMHCKAGDESPDVLEELSQAIETSDLEKSQSSDSFSQD
TSVTLMPVSVKLPVHPVENSVAEFDSHSGGSYCKLRSMIQPHGVSDQEKLSLDPGKLAKP
QMQQTQPQAYAYSDADTSAGGEPLQADGMAMIRSSLAALDNHGGDPLGSRASSTTYRNSE
GQFFSSMTLWGLAMKTLQNENELDQ
Download sequence
Identical sequences K7EVV5
XP_009238060.1.23681 ENSPPYP00000024691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]