SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024751 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024751
Domain Number 1 Region: 115-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000403
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 2 Region: 77-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000014
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 870-921
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000294
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 719-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000529
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 420-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000677
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 603-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000211
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 7 Region: 660-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000509
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 8 Region: 1168-1218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000724
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 9 Region: 1106-1160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000469
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024751
Domain Number - Region: 571-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000105
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 236-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000518
Family Classic zinc finger, C2H2 0.056
Further Details:      
 
Domain Number - Region: 348-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00223
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 201-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00392
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00914
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number - Region: 822-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0136
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024751   Gene: ENSPPYG00000007334   Transcript: ENSPPYT00000034017
Sequence length 1224
Comment pep:known_by_projection chromosome:PPYG2:16:36495749:36801621:-1 gene:ENSPPYG00000007334 transcript:ENSPPYT00000034017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIG
DGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRS
RDRHIKLHTGDKKYHCHECEAAFSRSDHLKIHLKTHSSSKPFKCTVCKRGFSSTSSLQSH
MQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQLSEKADLQCIHC
PEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPV
LGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFN
SLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAF
HCNYCPEMFADINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAH
CSVGSAKLESPVVQPTQSFMEVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSK
AEQSPVSSDVEVSSPKRQRLSASANSISNGEYPCNQCDLKFSNFESFQTHLKLHLELLLR
KQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLY
HCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVKHSHLGNPAKA
HKCIFCGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENG
TANGVPPTATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVL
LQNHRLRDHNIRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYM
CPICGERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGF
RCVVCMQTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLV
KLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGLRCPECSVKFESAEDLESHMQ
MDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANHMIEEGINHEC
KLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYD
CSQCPQKFFFQTELQNHTMSQHAQ
Download sequence
Identical sequences K7EW12
ENSPPYP00000024751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]