SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024762 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024762
Domain Number 1 Region: 351-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-22
Family KRAB domain (Kruppel-associated box) 0.0003
Further Details:      
 
Domain Number 3 Region: 392-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-19
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 6 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-17
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 7 Region: 448-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000239
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000149
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024762   Gene: ENSPPYG00000029767   Transcript: ENSPPYT00000034029
Sequence length 554
Comment pep:known_by_projection chromosome:PPYG2:19:12005542:12011076:1 gene:ENSPPYG00000029767 transcript:ENSPPYT00000034029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQDPVAFDDVAVNFTQEEWALLDISQRKLYREVMLETFRNLTSIGKRWKDQNIEYEYQN
PRRNFRSVIEKKVNEIKEDSHCGETFTPVPDDRLNFQEKKASPEVKSCESFVCGEVGLGN
SSFNMNIRGVTGHKAYEYQEYGPKPCKCQQPKKAFRYRPSFRTQERDHTGEKPNACKEFG
KTFISHSSVRRHMVMHSGDGPYKCKFCGKAFHCLSLYLIHERIHTGEKPCECKQCGKSFS
YSATLRIHKRTHTGEKPHEHQECEKAFHSPRSYRRHERSHTGEKAYQCKECGKAFTCPRY
VHIHERTHSRRKLYECKQCGKALSSLTSFQTHIRLHSGERPYECKICGKDFCSMNSFQRH
EKIHSGEKPYKCKQCGKAFPHSSSLRYHERTHTGEKPYECKQCGKAFRSASHLRVHGRTH
TGEKPYECKECGKAFRYVNNLQSHERTQTHIRIHSGERRYKCKLCGKGFYCPKSFQRHEK
THTGEKPYECKQHSVVPVPFDVMKGLTLERNCINVSNVGKPSELPQNFKCMAGPTLKRNP
MNVSNVGNRSAPHL
Download sequence
Identical sequences K7EW23
ENSPPYP00000024762 ENSPPYP00000024762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]