SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000096 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000096
Domain Number 1 Region: 8-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.4e-37
Family Cap-Gly domain 0.00074
Further Details:      
 
Domain Number 2 Region: 107-369
Classification Level Classification E-value
Superfamily L domain-like 2.72e-28
Family Internalin LRR domain 0.015
Further Details:      
 
Domain Number 3 Region: 440-527
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.92e-22
Family Ubiquitin-related 0.0000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000096   Gene: ENSPPYG00000000096   Transcript: ENSPPYT00000000104
Sequence length 527
Comment pep:known chromosome:PPYG2:1:14099001:14195329:-1 gene:ENSPPYG00000000096 transcript:ENSPPYT00000000104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTLTADVIGQRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFQ
CRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIM
KQQSQLSKLQEVSLRNCAVSCAGEKGGVAEGCPNIRKVDLSKNLLSSWDEVIHIADQLRH
LEVLNVSENKLKFPSGSVLTGTLSALKVLVLNQTGITWAEVLRCAMGCPGLEELYLESNN
IFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLEQLILSDIGISSLHFPDAGIG
CKTSLFPSLKYLVVNDNQISQWSFFNELDKLPSLRALSCLRNPLTKEDKEAETARLLIIA
SIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPDKNRLSEEFLTAHPRYQF
LCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSR
LLKVPVSDLLLSYESPQKPGVEIELENDLKSLQFYSVENGDCLLVRW
Download sequence
Identical sequences H2N3C8
9600.ENSPPYP00000000096 ENSPPYP00000000096 ENSPPYP00000000096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]