SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000797 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000797
Domain Number 1 Region: 238-349
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00047
Further Details:      
 
Domain Number 2 Region: 137-241
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00059
Further Details:      
 
Domain Number 3 Region: 21-127
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000797   Gene: ENSPPYG00000000688   Transcript: ENSPPYT00000000828
Sequence length 355
Comment pep:known_by_projection chromosome:PPYG2:1:93644449:93655485:1 gene:ENSPPYG00000000688 transcript:ENSPPYT00000000828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV
VCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA
GASCENPESSFFPVPEGVRLADGPGHCKGRVEVKHQNQWYIVCQTGWSLRAAKVVCRQLG
CGRAILTQKRCNKHAYGQRPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED
PFDLRLVGGNNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKSLSPSFKDRKY
YGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSGQYPGVLDA
Download sequence
Identical sequences H2N5A1
ENSPPYP00000000797 ENSPPYP00000000797 XP_009240954.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]