SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000805 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000805
Domain Number 1 Region: 754-981
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 350-526
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.32e-57
Family Regulator of G-protein signaling, RGS 0.0000000146
Further Details:      
 
Domain Number 3 Region: 985-1119
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-44
Family Pleckstrin-homology domain (PH domain) 0.000000272
Further Details:      
 
Domain Number 4 Region: 35-121
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-21
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000805   Gene: ENSPPYG00000000695   Transcript: ENSPPYT00000000836
Sequence length 1562
Comment pep:known_by_projection chromosome:PPYG2:1:94455282:94566395:1 gene:ENSPPYG00000000695 transcript:ENSPPYT00000000836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSSLGDSTPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGISGLQQDPFPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGSVDILPLY
GDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMA
RVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKDSRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLD
GDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTTEKAQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEV
KPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREE
MKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVIN
ELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLR
EEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYV
NEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKNLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTTVGSSDSKQTFSPVLKLNAVLIRSVATDK
RAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPMPVHPPPPGPQ
EPVHQGPIPSRVELDDSDVFHGEPEPEELPGGTGSQQRIQGKHPVLLEDPEQEDSAEKVE
LGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADSALEDVENLRHLILWSLLPGH
TMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGEGDNIQLAGLEGERPEQEDM
GLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGYKVVRKAEVAGSKVVPALPES
GQSEPGPPEVEGGTKATGNCFYVSMPSGPLDSSTDHSGAPTSPPQPDSLPAGQTEPQPQL
QGGNGDPRRPSHSPPSLALRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLGGESSGG
TTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPCPEDGSDAPLEDSAADAAASP
GP
Download sequence
Identical sequences H2N5A9
9600.ENSPPYP00000000805 XP_002810045.1.23681 ENSPPYP00000000805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]