SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000809 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000809
Domain Number 1 Region: 950-1243
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-76
Family Protein kinases, catalytic subunit 0.00000000138
Further Details:      
 
Domain Number 2 Region: 321-483
Classification Level Classification E-value
Superfamily L domain-like 7.66e-44
Family L domain 0.00000237
Further Details:      
 
Domain Number 3 Region: 28-161,222-237
Classification Level Classification E-value
Superfamily L domain-like 3.12e-37
Family L domain 0.00000368
Further Details:      
 
Domain Number 4 Region: 481-601
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-23
Family Fibronectin type III 0.0000343
Further Details:      
 
Domain Number 5 Region: 761-909
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-23
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 6 Region: 603-671,772-794
Classification Level Classification E-value
Superfamily Fibronectin type III 8.3e-18
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 7 Region: 201-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000505
Family Growth factor receptor domain 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000809   Gene: ENSPPYG00000000699   Transcript: ENSPPYT00000000840
Sequence length 1296
Comment pep:known_by_projection chromosome:PPYG2:1:94642394:94663481:1 gene:ENSPPYG00000000699 transcript:ENSPPYT00000000840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGMRLFLGYALVIFEM
PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
EDSCCVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSCL
AQCPSGFTRNGSSIFCHKCEGLCPKECKVGIKTIDSIQAAQDLVGCTHVEGSLILNLRQG
YNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQN
LQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRAA
CQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQ
SWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIIYLRTL
PAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRGL
RLPTSNNDPRFDREDGDPEAEMESNCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAI
TIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHFT
EYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPPD
PNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGSW
TDSVAFYILGPEEEDAGGLHVLLTATPVGITLLIVLAALGFFYGKKRNRTLYASVNPEYF
SASDMYIPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASP
RECIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAENN
PGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVY
ETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQV
LKFVMDGGVLEELDGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFYY
SPECRGTRGSLPPTDAEPDSSPTPRDCSPQNGGPGH
Download sequence
Identical sequences H2N5B3
ENSPPYP00000000809 9600.ENSPPYP00000000809 ENSPPYP00000000809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]