SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001718 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001718
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-25
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 308-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.84e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 158-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001718   Gene: ENSPPYG00000001486   Transcript: ENSPPYT00000001774
Sequence length 378
Comment pep:known chromosome:PPYG2:1:189550763:189566758:-1 gene:ENSPPYG00000001486 transcript:ENSPPYT00000001774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINFQESVTFQDVAVDFTVEEWQLLDCAERTLYWDVMLENYRNLISVGFPITKTKVILKV
EQGQEPWMVEGVNPHQSSPESDCPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYN
MSTSLNPMRKKSYKSFEKRLPPNLDLLKYNRSYTVENAYECTECGKAFKKKFHFIRHEKN
HTRKKPFECNDCGKAYSRKAHLVTHQKIHNGERSFVCNDCGKAFMHKAQLVVHQRLHTGE
KPYECSQCGKTFTWNSSFNQHVKSHTLEKSFECKECGKTFRYSSSLYKHSRFHTGEKPYQ
CIICGKAFGNTSVLVTHQRIHTGEKPYGCIECGKAFIKKSHLLRHQITHTGEKPYECNRC
GKAFSQKSNLIVHQKIHT
Download sequence
Identical sequences H2N7T9
ENSPPYP00000001718 XP_009249946.1.23681 ENSPPYP00000001718 9600.ENSPPYP00000001718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]