SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001720 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001720
Domain Number 1 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 71-132
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 326-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000248
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001720
Domain Number - Region: 229-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00143
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0032
Family SCAN domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001720   Gene: ENSPPYG00000001488   Transcript: ENSPPYT00000001776
Sequence length 526
Comment pep:known_by_projection chromosome:PPYG2:1:189602708:189618422:-1 gene:ENSPPYG00000001488 transcript:ENSPPYT00000001776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLITLPTEASTWVKLRHPKKAVEGAPLWEDVTKMFEGEALLSQDADHIKTQRESLE
DEVTPGLPTAESQELLTFKDISIDFTQEEWGQLAPAHQNLYREVMLENYSNLVSVGYQLS
KPSVISQLEKGEEPWMAEKEGPGDPSSDSKSKMETTESTAKSAISQERLYHGIMMERFMR
DDILYSTLRKVSTYDDVLERHQETCVRDVRQAILTHKKRVQETNKFGENIIVHSNVIIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
CKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKC
QKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF
SHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDS
SFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNNV
Download sequence
Identical sequences H2N7U1
XP_009250190.1.23681 XP_009250195.1.23681 9600.ENSPPYP00000001720 ENSPPYP00000001720 ENSPPYP00000001720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]