SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002185 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002185
Domain Number 1 Region: 75-258
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.38e-75
Family F-box associated region, FBA 0.00000164
Further Details:      
 
Domain Number 2 Region: 10-92
Classification Level Classification E-value
Superfamily F-box domain 3.27e-17
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002185   Gene: ENSPPYG00000001886   Transcript: ENSPPYT00000002252
Sequence length 293
Comment pep:known_by_projection chromosome:PPYG2:1:218629059:218641738:-1 gene:ENSPPYG00000001886 transcript:ENSPPYT00000002252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPHPKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLR
EGFITEDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAH
GTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YQLKVQLASADYFVLASFEPPPVTIQQWNNAAWTEVSYTFSDYPRGVRYILFQHGGRDTQ
YWAGWYGPRVTNSSIVVSPKMTRNQASSETQPGQKHGQEEAAQSPYQAVLQIF
Download sequence
Identical sequences H2N941
XP_009233524.1.23681 9600.ENSPPYP00000002185 ENSPPYP00000002185 ENSPPYP00000002185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]