SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002762 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002762
Domain Number 1 Region: 81-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.95e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002762   Gene: ENSPPYG00000002380   Transcript: ENSPPYT00000002856
Sequence length 214
Comment pep:known_by_projection chromosome:PPYG2:10:65840038:65840682:1 gene:ENSPPYG00000002380 transcript:ENSPPYT00000002856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPQPSGAPTVQVTRETERSFPRASDDEVTCPTSAPPSPTRTRGNCAEAEGGGCRGAPRK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSLYALESPAPHCGELGSPGGSPGDWGSLYSPVSQAG
SLSPAASLEERPGLRGATSSACLSPGALAFSDFL
Download sequence
Identical sequences H2NAP3
ENSPPYP00000002762 9600.ENSPPYP00000002762 XP_002820920.1.23681 ENSPPYP00000002762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]