SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004041 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004041
Domain Number 1 Region: 450-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.86e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 562-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 26-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 338-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 283-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000341
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 244-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000308
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004041   Gene: ENSPPYG00000003523   Transcript: ENSPPYT00000004199
Sequence length 633
Comment pep:known chromosome:PPYG2:11:63450805:63454113:1 gene:ENSPPYG00000003523 transcript:ENSPPYT00000004199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAKCLYLCPSSHLDFFFLESLIFDQMAVTFEDVTIIFTWEEWKFLDSSQKRLYREVMW
ENYTNVMSVENWNESYKSQEEKFRYLEYENFSCWQGWWNAGAQMYKNQNYGETVQGTDSK
DLTQQDHSQCHEWLILSTQVPGYGNYELTFESKSRRNLKYKNFMPWQSLETKTTQDYGRE
IYMSGSHGFQGGRYRLGISRKNLSMEKEQKLIVQHSYIPVEEALPQYVGVICQKDLLRDS
TEEKYCGCNKCKEIYYWNSRCVFHKRNQPGENLYQCSIRKACFSQRSDLYRHPRIHIGKK
LYGCDEVDGNFHQSSGVHFHQRVHIGEVPYSCNACDKSFSRISSLHNHQRVHTEEKFYKI
KCDKDLSRNSLLHIHQRLHIGEKPFKCNQCGKSFNRSSVLHVHQRVHTGEKPYKCNECGK
GFSQSSNLRIHQLVHTGEKSYKCEDCGKGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSH
SSDLRIHQRVHTGEKPYTCPECGKGFSKSSKLHTHQRVHTGEKPYKCEECGKGFSQRSHL
LIHQRVHTGEKPYKCDDCGKGFSHSSNLHIHQRVHTGEKPYQCAKCGKGFSHSSALRIHQ
RVHTGEKPYKCREYYKGFDHNSHLHSSHRRGNL
Download sequence
Identical sequences H2NE77
ENSPPYP00000004041 ENSPPYP00000004041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]