SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004091 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004091
Domain Number 1 Region: 649-840
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-47
Family SPRY domain 0.0000414
Further Details:      
 
Domain Number 2 Region: 23-116
Classification Level Classification E-value
Superfamily RING/U-box 3.77e-30
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Domain Number 3 Region: 356-440
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-23
Family RING finger domain, C3HC4 0.0057
Further Details:      
 
Domain Number 4 Region: 116-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.13e-17
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Domain Number 5 Region: 445-506
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.63e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004091   Gene: ENSPPYG00000003565   Transcript: ENSPPYT00000004252
Sequence length 842
Comment pep:known_by_projection chromosome:PPYG2:11:64759935:64819062:-1 gene:ENSPPYG00000003565 transcript:ENSPPYT00000004252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSERILQAGNILEIRAGQAGARRVATMTSPVLMDIREEVTCPICLELLTEPLSIDCGH
SFCQACITPNSRESVIGQEGERSCPVCQTSYQPGNLRPNRHLANIVRRLREVVLGPGKQL
KAVLCADHGEKLQLFCQEDGKVICWLCERSQEHRGHHTFLVEEVAQEYQEKFKESLKKLK
NEEQEAETLTAFIREKKTSWKNQMEPERRRIQTEFNQLRNILDRVEQRELKKLEQEEKKG
LRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPT
KLRSMFRAPDLKRMLRVFRELTDVQSYWATQGSLTRRERRASGVRTRRSQGSSAMASKIL
LNVQEEVSCPICLELLTEPLSLGCGHSLCRACITVSNKEAVTSPGEKSSCPVCGISYSFE
HLQANQHLANIVERLKEVKLSPDNGKKRDLCDRHGEKLLLFCKEDRKVICWLCERSQEHR
GHHTVLTEEVFKECQEKLQAVLKRLKKEEEEAEKLEADIREEKTSWKYQVQTERQRIQIE
FDQLRSILNSEEQRELQRLEEEEKQTLDKFAEAEDELVQQKQLVRELISDVECRSQWSTM
ELLQDMSGIMKWSEIWRLKKPKTVSKKLKTVFHAPDLSRMLQMFRELTAVRCYWVDITLN
SVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGVY
CRTYSRNMKYVVRRCANHQNLSSKYRPLFGYWVIGLQNKCKYSAFEESLSSDPEVLTLSM
AVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYKFSKCCFSQPVYPYFNPWNCPAPMTLCPP
SS
Download sequence
Identical sequences H2NEC4
ENSPPYP00000004091 9600.ENSPPYP00000004091 ENSPPYP00000004091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]