SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004303 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004303
Domain Number 1 Region: 214-310
Classification Level Classification E-value
Superfamily HMG-box 2.62e-20
Family HMG-box 0.0000355
Further Details:      
 
Domain Number 2 Region: 92-173
Classification Level Classification E-value
Superfamily HMG-box 1.96e-19
Family HMG-box 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004303   Gene: ENSPPYG00000003759   Transcript: ENSPPYT00000004477
Sequence length 390
Comment pep:novel chromosome:PPYG2:11:85632252:85633421:-1 gene:ENSPPYG00000003759 transcript:ENSPPYT00000004477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRSQGHWSNTDLLRLLECMQNNLPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKW
LEISCNLRKFSTFKELVLETKKCVKKMNKSQKCRNHPDFPKRPLTAYNRFFKESWPQYSQ
MYPGKRSQELTKILSKKYKELPEQMKQKYIQDFQKEKQEFEEKLARFREEHPDFVQKSKK
SGVSKRTQIKVQKKVQKNVEEVRSLPKTDQFFKKVKFHGEPQKPPMNGYHKFHQDSWSSK
ELQHLSMRERMVEIGRRWQRIPQSQKDHLKSQAEELQKQYKVKLDLWLKTLSPENYAAYK
ESTYAKGKNMAITGGLDTRLKQADPQSSSAKGLQEGFGDGQGLQPARTDSSQTSWVNCHV
SMEPEENRKKDAEEEESSNSSDCSSGEEME
Download sequence
Identical sequences H2NEX6
9600.ENSPPYP00000004303 ENSPPYP00000004303 ENSPPYP00000004303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]