SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004692 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004692
Domain Number 1 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 6-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-17
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 219-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000524
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 123-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000119
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 261-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000598
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004692   Gene: ENSPPYG00000004114   Transcript: ENSPPYT00000004877
Sequence length 297
Comment pep:novel chromosome:PPYG2:11_random:4708153:4713109:-1 gene:ENSPPYG00000004114 transcript:ENSPPYT00000004877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THSLKKVTFEDVAIDFTQEDWAMMDTSRRKLYRNVMLENISHLVSLQISKYCITLLEQGK
ELWQEGREFLQDQNPDRESALKKKHMTSMHPIIRKDASTSMTMENSLILEDPFECNDLGE
DCTHSSTITQCLLTHSGKKPYVSKQYGKSLSNQLSPKPHKQIHTKCKSYQWNLCEKAYTN
CFHLRRHKMTHTGERPYACDLCGKAFTQCSHLRRHEKTHMGERSYKCHQCGKAFIQSFNL
RRHERTHLGKKCYECDKSGKAFSQSSGFRGNKVIHTGEKPHACLLCRKAFSLSPNLR
Download sequence
Identical sequences H2NG06
ENSPPYP00000004692 ENSPPYP00000004692 9600.ENSPPYP00000004692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]