SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005000 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005000
Domain Number 1 Region: 370-470
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 108-179
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.9e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 191-245,273-287
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000838
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005000   Gene: ENSPPYG00000004380   Transcript: ENSPPYT00000005197
Sequence length 636
Comment pep:known_by_projection chromosome:PPYG2:12:28404020:28496010:1 gene:ENSPPYG00000004380 transcript:ENSPPYT00000005197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPS
QSGIMTEKVVEKLSQNPLTYLLSTRIEISASSGSRVEDGEHQVKMKAFREAHSQTEKRRR
DKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHLRSLKGLTNSYVGNNYRPSFLQDN
ELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVK
EQLSSFDISPREKLIDAKTGLQVHSNLHTGRTRVYSGSRRSFFCRIKSCKISVKEEHGCL
PNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIGRLQPYVVPQN
SGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKH
KAVLQSKEKIFTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGE
ASFFPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSS
PTDLMKDTHTVNCRSMSNRESFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFD
ALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences H2NGV4
9600.ENSPPYP00000005000 XP_002823102.1.23681 ENSPPYP00000005000 ENSPPYP00000005000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]