SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005084 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005084
Domain Number 1 Region: 1-298
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.94e-90
Family Phosphofructokinase 0.000000975
Further Details:      
 
Domain Number 2 Region: 335-717
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.27e-85
Family Phosphofructokinase 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005084   Gene: ENSPPYG00000004453   Transcript: ENSPPYT00000005284
Sequence length 749
Comment pep:known chromosome:PPYG2:12:47769258:47781452:1 gene:ENSPPYG00000004453 transcript:ENSPPYT00000005284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMNAAVRFEVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSAR
CKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDE
EATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVM
GRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAID
KNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILVSHWALQGLTSLVALP
LHQPLGCIRLWDGDPAVQNPDPGVETVTTKDVTKAMDEKKFDELKLRGRSFMNNWEVYKL
LAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQ
IEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLE
LMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTANTICTTCDRIKQSAAGTKRRVF
IIETMGGYCGYLAMAGLAAGADAAYIFSPSPFRDLQANVEHLVQKMKTTVKRGLVLRNEK
CNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFRNFATKMGAIEAMNWMSGK
IKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTELKDQTDFEHRIPKEQWWLKLRPILK
IAKYEIDLDTSDHAHLEHITRKRSGEAAV
Download sequence
Identical sequences H2NH37
9600.ENSPPYP00000005084 ENSPPYP00000005085 ENSPPYP00000005084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]