SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005111 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005111
Domain Number 1 Region: 26-184
Classification Level Classification E-value
Superfamily CBS-domain pair 7.56e-43
Family CBS-domain pair 0.000000052
Further Details:      
 
Domain Number 2 Region: 188-324
Classification Level Classification E-value
Superfamily CBS-domain pair 4.91e-33
Family CBS-domain pair 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005111   Gene: ENSPPYG00000004477   Transcript: ENSPPYT00000005312
Sequence length 331
Comment pep:known_by_projection chromosome:PPYG2:12:48661406:48678791:-1 gene:ENSPPYG00000004477 transcript:ENSPPYT00000005312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVISSDSSPALENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
Download sequence
Identical sequences A0A0D9R1J8 A0A2K5WZ55 A0A2K6BZA8 A0A2K6KED4 A0A2K6QG99 G3RW69 H2NH63 H9EQE8
9600.ENSPPYP00000005111 ENSGGOP00000011004 ENSPPYP00000005111 ENSPPYP00000005111 NP_001252961.1.72884 XP_002823223.1.23681 XP_004053112.1.27298 XP_005570796.1.63531 XP_008001300.1.81039 XP_010383720.1.97406 XP_011758543.1.29376 XP_011791604.1.43180 XP_011842998.1.47321 XP_017750226.1.44346 ENSGGOP00000020051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]