SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005202 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005202
Domain Number 1 Region: 280-357
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.94e-26
Family Intermediate filament protein, coiled coil region 0.00025
Further Details:      
 
Domain Number 2 Region: 50-84
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000497
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 86-157
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000146
Family Intermediate filament protein, coiled coil region 0.012
Further Details:      
 
Domain Number 4 Region: 174-281
Classification Level Classification E-value
Superfamily Prefoldin 0.0000523
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005202   Gene: ENSPPYG00000004562   Transcript: ENSPPYT00000005405
Sequence length 443
Comment pep:known chromosome:PPYG2:12:52657719:52665983:-1 gene:ENSPPYG00000004562 transcript:ENSPPYT00000005405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RISSSSSRVSSSFGLGGYGGSGMGGITAVTVNQSLSPVLEVDPNIAVRTQEKEQIKTLNN
KFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLK
LEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDE
INFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAES
MYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQ
RGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEES
RLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYGLGSSFGSGAGSSSFSRTSSSRA
VVVKKIETRDGKLVSESSDLLPK
Download sequence
Identical sequences H2NHF0
9600.ENSPPYP00000005202 ENSPPYP00000005202 ENSPPYP00000005202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]