SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005870 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005870
Domain Number 1 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 331-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-21
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005870
Domain Number - Region: 134-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0575
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005870   Gene: ENSPPYG00000005150   Transcript: ENSPPYT00000006097
Sequence length 389
Comment pep:novel chromosome:PPYG2:12:136027268:136058412:-1 gene:ENSPPYG00000005150 transcript:ENSPPYT00000006097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQSQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLVFLEVWLDNPKMWLRDNQ
DNLKNMERGHKYDVFGKIFNSSVNIVQVAMRSHKCGTGEKSLKCPFDLLIPKNNCERKKI
DELNKKLLFCIKPDRTHGGIKYCDCNTCRKSSNKEPWHTANHVTHTGVYLCMECGRFFNK
KSQLIIHQRTHTGEKPYKCSECGKAFSQKSLLTVHQRTHSGEKPHGCSECQKAFSRKSLL
ILHQRIHTGEKPYGCSECGKAFSRKSQLKRHQITHTIEKPYSCSECGKAFSQKLKLITHQ
RTHTGEKPYTCSHCGKAFFWKSQLITHQRTHTGKKPYACSECQKAFSRNSLLIRHQRIHT
GEKPYECNECGEAFIRKPQLIKHQITHTG
Download sequence
Identical sequences H2NJ82
ENSPPYP00000005870 ENSPPYP00000005870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]