SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005891 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005891
Domain Number 1 Region: 122-199
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.79e-24
Family Intermediate filament protein, coiled coil region 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005891
Domain Number - Region: 13-122
Classification Level Classification E-value
Superfamily Prefoldin 0.000162
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005891   Gene: ENSPPYG00000005174   Transcript: ENSPPYT00000006123
Sequence length 292
Comment pep:novel chromosome:PPYG2:12_random:10830040:10832526:-1 gene:ENSPPYG00000005174 transcript:ENSPPYT00000006123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDAAYMNKVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDS
IIAEVKAQYEEIAQRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLR
SEIDHVKKQCASLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELM
NVKLALDVEIATYRKLLEGEECRLNGEGVGQVNVSVVQSTVSSGYGGASGVGSGLGLGGG
SSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH
Download sequence
Identical sequences H2NJA3
XP_002833740.2.23681 ENSPPYP00000005891 ENSPPYP00000005891 9600.ENSPPYP00000005891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]