SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006058 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006058
Domain Number 1 Region: 356-489,788-961
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.63e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 88-211
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-29
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 1167-1233
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3e-19
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 
Domain Number 4 Region: 257-326
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000451
Further Details:      
 
Domain Number 5 Region: 195-252
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006058   Gene: ENSPPYG00000005318   Transcript: ENSPPYT00000006295
Sequence length 1241
Comment pep:known_by_projection chromosome:PPYG2:13:42006891:42207092:1 gene:ENSPPYG00000005318 transcript:ENSPPYT00000006295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQHVRPAPGARSPAWEEPESERMAGAGGQHHPPGAAGGAAAGASAAVTSAAASAGPGE
DSSDSEAEQEGPQKLIRKVSTSGQIRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYY
AKDSKSLIFDEVDLSDASVAEASTKNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSV
QTREPYEVAQFNVEHFSGMHNWYACSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKR
CAVRATNNCKWTTLASIGKDIIEDEDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQD
WKCLWCKTMVHTACKDLYHPICPLGQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVF
VNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGW
VLSEIDKLNLNKQCQLGVLPLGTGNDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDR
WSIMTYELKLPPKASLLPGPPEASEEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLC
ETVKDFVAKVEKTYDKTLENAVVADAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSP
LIVEEDAVESSSEESLGESKEQLVDDVTKPSSQKAVPREIMLRANSLKKAVRQVIEEAGK
VMDDSTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESLTVKTAPRSPDARASYGHSQT
DSVPGPAVAASKENLPVLNTRIICPGLRAGLAAQLLGVINKMLLANIDPFGATPFIDPDP
DSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQR
SYKNLEQRVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKIL
EVVAIFDSMQMAVSRVIKLQHHRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVH
KNRAQMLTKGQAFESTLKSWEDKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAA
EELITRICDAATIHCLLEQELAHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYN
ETESLLVGRVPLQLESPHEERVSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTK
RNNRSTVFRIVPKFKKEKVQKQKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRG
AELLHLERRDLKDLGIPKVGHVKRILQGIKELGRSTPQSEV
Download sequence
Identical sequences H2NJR5
ENSPPYP00000006058 ENSPPYP00000006058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]