SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006170 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006170
Domain Number 1 Region: 845-1026
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 1001-1121
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.18e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 3 Region: 189-235,353-422
Classification Level Classification E-value
Superfamily PH domain-like 7e-23
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006170
Domain Number - Region: 1125-1208
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006170   Gene: ENSPPYG00000005417   Transcript: ENSPPYT00000006414
Sequence length 1251
Comment pep:known_by_projection chromosome:PPYG2:13:76709288:76913664:-1 gene:ENSPPYG00000005417 transcript:ENSPPYT00000006414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSATQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPSQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHQQRLKIQG
EQRSPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAGAGQPALTSSRVCFPERIL
EDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQV
GRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQCA
SESLLYPPRAKLVIQRHLSSLTDNEQADIFERVQKMKPISDQEENELVILHLRQLCEAKQ
KTHVHIGEGPSTISNSSIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRL
GSVDSFERSNSLASEKDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHP
PSSTKRKLNLQDGRAQGVRSPLLRQSSSEQCSTLSSVRRMYKESNSSSSLPSLHTSFSAP
SFTAPSFLKSFYQNSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSVGGTSVT
PRRISWRQRIFLRVASPMNKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLIIFLSGEDD
PEKIEGRKKSKELRSLWRKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGACQ
KEVLITWDKKLLNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQ
PPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVG
YCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYH
RDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALLLSSQ
ETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQ
EYSYSCEDSEPLEKLERANSQLKRQNMDLLEKLQVAHAKIQALESNLENLLTRETKMKSL
IRTLEQEKIAYQKTVEQLRKLLPADALANCELLLRDLNCNPNNKAKIGNKP
Download sequence
Identical sequences H2NK21
9600.ENSPPYP00000006170 ENSPPYP00000006170 ENSPPYP00000006170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]