SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006500 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006500
Domain Number 1 Region: 586-851
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-81
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 423-541
Classification Level Classification E-value
Superfamily PH domain-like 3.1e-32
Family Pleckstrin-homology domain (PH domain) 0.0000118
Further Details:      
 
Domain Number 3 Region: 125-197
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.36e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 263-321
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006500   Gene: ENSPPYG00000005718   Transcript: ENSPPYT00000006756
Sequence length 912
Comment pep:known_by_projection chromosome:PPYG2:14:29151218:29525196:-1 gene:ENSPPYG00000005718 transcript:ENSPPYT00000006756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKTA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGLSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIQLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDTEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPAKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPPPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEQYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
Download sequence
Identical sequences H2NKY5
9600.ENSPPYP00000006500 ENSPPYP00000006500 XP_002824686.1.23681 ENSPPYP00000006500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]